PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009784397.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 276aa    MW: 30319.5 Da    PI: 8.9989
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009784397.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1231e-3842102262
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                     k++a++cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGgg+rkn++ s
  XP_009784397.1  42 KDQAVNCPRCNSTNTKFCYYNNYSLTQPRYFCKTCRRYWTEGGTLRNVPVGGGSRKNRRCS 102
                     7899*****************************************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-2935100IPR003851Zinc finger, Dof-type
PfamPF027011.4E-3243100IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.9146100IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104884IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MDTTQWTQDI GLVTSMAAEI APPNITCSRP SSPLEKKVRP QKDQAVNCPR CNSTNTKFCY  60
YNNYSLTQPR YFCKTCRRYW TEGGTLRNVP VGGGSRKNRR CSSSSLSLSS SSQNFPDSNP  120
NPSLSHQNPN YKINLGNSQD FNLGLPSITH DHNYFHSVPQ FLEFPKMDRG NNGNNQPLSS  180
TSSTTPISTT DLLRTGIASR GLTSFISTPT PDINALYTSS FLSGVQENGA KIMFPFGYLN  240
KQLSGTSAEA ENYNQSKGQE NSSAGYWNGM LGGGSW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755222e-65HG975522.1 Solanum lycopersicum chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009784397.10.0PREDICTED: dof zinc finger protein DOF2.5-like
RefseqXP_016474421.10.0PREDICTED: dof zinc finger protein DOF2.5-like
TrEMBLM1BMN51e-127M1BMN5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000486121e-126(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.49e-47Dof family protein